PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4DS_2A5B4C4C4.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 279aa    MW: 31148.5 Da    PI: 5.7871
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4DS_2A5B4C4C4.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.72.3e-171158148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           rg+WT +Ed+ l+++++ +G g+W++ ar  g++Rt+k+c++rw++yl
  Traes_4DS_2A5B4C4C4.1 11 RGPWTVDEDLTLINYIADHGEGRWNALARAAGLRRTGKSCRLRWLNYL 58
                           89********************************************97 PP

2Myb_DNA-binding55.81.1e-1764107146
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                            rg++T++E++l++d++ ++G++ W++Ia++++ gRt++++k++w++
  Traes_4DS_2A5B4C4C4.1  64 RGNFTADEQLLILDLHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 107
                            89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.404658IPR017930Myb domain
SuperFamilySSF466892.92E-309105IPR009057Homeodomain-like
SMARTSM007171.1E-141060IPR001005SANT/Myb domain
PfamPF002497.6E-161158IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-221265IPR009057Homeodomain-like
CDDcd001677.18E-111358No hitNo description
PROSITE profilePS5129423.8659113IPR017930Myb domain
SMARTSM007171.2E-1563111IPR001005SANT/Myb domain
PfamPF002493.9E-1664107IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-2466112IPR009057Homeodomain-like
CDDcd001671.29E-1166107No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0016036Biological Processcellular response to phosphate starvation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0005516Molecular Functioncalmodulin binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
AEPEEEAELR RGPWTVDEDL TLINYIADHG EGRWNALARA AGLRRTGKSC RLRWLNYLRP  60
DVKRGNFTAD EQLLILDLHS RWGNRWSKIA QHLPGRTDNE IKNYWRTRVQ KHAKQLNCDV  120
GSATFKDAMR YLWMPRLVER IHATAAPTGG DPTIGDTSCA SGVTSMATTA ATATTYPENN  180
SPSSAVTTSR SASSGSFTSE LCGEEKNLHV HGSGEKTTSG GDWMQDADQE FWAMHMQIQP  240
DEGGLFHVDH ELSGWVQGFS DVGVSADNLW SLEDIWKMQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-2581111103MYB PROTO-ONCOGENE PROTEIN
1h8a_C2e-25811124126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0090180.0BT009018.1 Triticum aestivum clone wdk3c.pk006.n12:fis, full insert mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006663109.11e-121PREDICTED: transcription factor MYB108-like
SwissprotQ9LDE18e-76MY108_ARATH; Transcription factor MYB108
TrEMBLM8BCJ50.0M8BCJ5_AEGTA; Transcription factor MYB21
STRINGOB11G27320.11e-120(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49620.19e-70myb domain protein 78